Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:3261

Acvr1 activin A receptor, type 1 ( MGI:87911)
TS13 (8.5 dpc)
immunohistochemistry

Data Images
EMAGE:3261
Fig3B of Yoshikawa et al, 2000 [PMID:10704880] . Copyright: Reprinted with permission from Elsevier from [doi:10.1016/S0925-4773(99)00320-2] Mech Dev 91: 439-44, Yoshikawa SI; Aota S; Shirayoshi Y; Okazaki K, The ActR-I activin receptor protein is expressed in notochord, lens placode and pituitary primordium cells in the mouse embryo. Copyright 2000

Expression pattern clarity: three stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Notes:
Image annotations: FB - forebrain, FG - foregut, H - heart, N - notochord, BA - branchial arch, Arrow - bottle shaped cells at the rostral extremity of the notochord.
Expression Pattern Description
Spatial Annotation:
EMAGE:3261Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
3261_wholemount_strong_3D_1.wlz
3261_wholemount_moderate_3D_1.wlz
3261_wholemount_notDetected_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:3261_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: two stars
Text Annotation:
StructureLevelPatternNotes
branchial arch
detected detected
notochord
detected detected
Expression is in the bottle-shaped cells at the rostral extremity of the notochord
gut
detected detected
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MGI:2135883
Entity Detected:Acvr1, activin A receptor, type 1 ( MGI:87911)
Antigen:sense strand is shown

>MGI:2135883
MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC
FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
aa 1 - aa 123 of NP_031420.2
Notes:The antibody used in this study by Yoshikawa et al, 2000 [PMID:10704880] is described as "mAb 2A7". The region of the ACVR1 (ActR-I/ALK2) protein used as antigen in its production was the "extracellular region (Met1-Glu123) of mouse ActR-I". The antibody recognizes product in Western blot when antigen is unreduced.
Antibody Type:monoclonal
Raised In:rat
Supplier:produced in Okazaki lab
Catalogue Number:2A7
Specimen
Organism:mouse
Strain:ICR
Age:8.5 dpc
Theiler Stage:TS13
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Fixation:methanol/DMSO 4:1
Secondary Antibody:sheep anti-rat Ig
Labelled with:HRP
Visualisation method:DAB
General Information
Authors:Yoshikawa SI, Aota S, Shirayoshi Y, Okazaki K (2000) [PMID:10704880] . Indexed by GXD, Spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/S0925-4773(99)00320-2] [ PMID:10704880] Yoshikawa SI, Aota S, Shirayoshi Y, Okazaki K 2000 The ActR-I activin receptor protein is expressed in notochord, lens placode and pituitary primordium cells in the mouse embryo. Mech Dev (91):439-44
Links:MGI:2387659 same experiment
  Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceMGI