Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:3262

Acvr1 activin A receptor, type 1 ( MGI:87911)
TS11 (7.5 dpc)
immunohistochemistry

Data Images
EMAGE:3262
Fig4A of Yoshikawa et al, 2000 [PMID:10704880] . Copyright: Reprinted with permission from Elsevier from [doi:10.1016/S0925-4773(99)00320-2] Mech Dev 91: 439-44, Yoshikawa SI; Aota S; Shirayoshi Y; Okazaki K, The ActR-I activin receptor protein is expressed in notochord, lens placode and pituitary primordium cells in the mouse embryo. Copyright 2000

Expression pattern clarity: three stars
Find spatially similar expression patterns: Find spatially similar patterns
Notes:
Image annotations: NE - neural ectoderm, M - mesoderm, VE - visceral endoderm. Bar indicates 100 um
Expression Pattern Description
Spatial Annotation:
EMAGE:3262EMAGE:3262Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
3D mappingspatial mapping

View mapped 3D expression image EMAGE genex expression entry
Download individual expression domains:
3262_voxel_strong_3D_1.wlz
3262_voxel_moderate_3D_1.wlz
3262_voxel_possible_3D_1.wlz
3262_voxel_notDetected_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:3262_all_domains.zip
Find spatially similar expression patterns: EMAGE spatially similar patterns
Morphological match to the template: two stars
Text Annotation:
StructureLevelPatternNotes
embryo ectoderm
not detected not detected
homogeneousExpression is described as being absent from embryonic epiblast.
visceral extraembryonic endoderm
detected detected
homogeneousProtein is detected in the extraembryonic layer, predominantly in the visceral endoderm.
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MGI:2135883
Entity Detected:Acvr1, activin A receptor, type 1 ( MGI:87911)
Antigen:sense strand is shown

>MGI:2135883
MVDGVMILPVLMMMAFPSPSVEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGC
FQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
aa 1 - aa 123 of NP_031420.2
Notes:The antibody used in this study by Yoshikawa et al, 2000 [PMID:10704880] is described as "mAb 2A7". The region of the ACVR1 (ActR-I/ALK2) protein used as antigen in its production was the "extracellular region (Met1-Glu123) of mouse ActR-I". The antibody recognizes product in Western blot when antigen is unreduced.
Antibody Type:monoclonal
Raised In:rat
Supplier:produced in Okazaki lab
Catalogue Number:2A7
Specimen
Organism:mouse
Strain:ICR
Age:7.5 dpc
Theiler Stage:TS11
Mutations:none (wild-type)
Preparation:section
Procedures
Fixation:methanol/DMSO 4:1
Secondary Antibody:sheep anti-rat Ig
Labelled with:horse radish peroxidase
Visualisation method:DAB
General Information
Authors:Yoshikawa SI, Aota S, Shirayoshi Y, Okazaki K (2000) [PMID:10704880] . Indexed by GXD, Spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/S0925-4773(99)00320-2] [ PMID:10704880] Yoshikawa SI, Aota S, Shirayoshi Y, Okazaki K 2000 The ActR-I activin receptor protein is expressed in notochord, lens placode and pituitary primordium cells in the mouse embryo. Mech Dev (91):439-44
Links:MGI:2387659 same experiment
  Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceMGI