Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:3399

Isl1 ISL1 transcription factor, LIM/homeodomain ( MGI:101791)
TS15 (9.5 dpc)
immunohistochemistry

Data Images
EMAGE:3399 EMAGE:3399
Figure 1H of Ericson et al., 1998 [PMID:9463347] . Copyright: This image is from Ericson et al., Development 125:1005-1015. (1998), and is displayed with the permission of The Company of Biologists Limited who owns the Copyright. Figure 1L of Ericson et al., 1998 [PMID:9463347] . Copyright: This image is from Ericson et al., Development 125:1005-1015. (1998), and is displayed with the permission of The Company of Biologists Limited who owns the Copyright.

Expression pattern clarity: three stars
Find spatially similar expression patterns: Find spatially similar patterns
Notes:
Note: Figure 1L: Schematic representation of gene expression and cell differentiation during pituitary development: gray/red checkered, Isl1+/Lhx3+ cells; gray, Lhx3+ cells; light red, Isl1+/alphaGSU+ presumptive thyrotrophs; red, Isl1+/alphaGSU+/TSHbeta+ definitive thyrotrophs; green, ACTH+ definitive corticotrophs. H, presumptive hypothalamus; RP, Rathkes pouch; INF, infundibulum.
Expression Pattern Description
Spatial Annotation:
EMAGE:3399EMAGE:3399Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
3D mappingspatial mapping

View mapped 3D expression image EMAGE genex expression entry
Download individual expression domains:
3399_voxel_strong_3D_1.wlz
3399_voxel_notDetected_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:3399_all_domains.zip
Find spatially similar expression patterns: EMAGE spatially similar patterns
Morphological match to the template: three stars
Text Annotation:
StructureLevelPatternNotes
rathke's pouch
detected detected
homogeneous
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MGI:2148090
Entity Detected:Isl1, ISL1 transcription factor, LIM/homeodomain ( MGI:101791)
Antigen:sense strand is shown

>MGI:2148090
PEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIMMKQLQ
QQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQSDIDQPAFQQLVNFSEG
GPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
aa 178 - aa 349 of NP_059035.3
Notes:The anti-Isl1 antibody used in this study by Ericson et al., 1998 [PMID:9463347] was originally described by Thor et al., 1991 [PMID:1764243] . It was raised against a 25kDa truncated rat Isl1 protein "C-Isl-1". This is encoded by amino acid residues 178-349 (Karlsson et al, 1990 [PMID:1691825] . Note that residue 178 was changed to Methionine during the cloning procedure. Antigen recognition note: This antibody was produced before the existence of Isl2 was known. It was later shown that the antibody recognizes both Isl1 and Isl2.
Antibody Type:polyclonal
Raised In:rabbit
Specimen
Organism:mouse
Strain:either: CBA or C57BL/6
Age:9.5 dpc
Theiler Stage:TS15
Mutations:none (wild-type)
Preparation:section
Procedures
General Information
Authors:Ericson J; Norlin S; Jessell TM; Edlund T, 1998 [PMID:9463347] . Indexed by GXD, Spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ PMID:9463347] Ericson J, Norlin S, Jessell TM, Edlund T 1998 Integrated FGF and BMP signaling controls the progression of progenitor cell differentiation and the emergence of pattern in the embryonic anterior pituitary. Development (125):1005-15
 [ doi:10.1016/0896-6273(91)90334-V] [ PMID:1764243] Thor S, Ericson J, Brannstrom T, Edlund T 1991 The homeodomain LIM protein Isl-1 is expressed in subsets of neurons and endocrine cells in the adult rat. Neuron (1991):881-9
 [ doi:10.1038/344879a0] [ PMID:1691825] Karlsson O, Thor S, Norberg T, Ohlsson H, Edlund T 1990 Insulin gene enhancer binding protein Isl-1 is a member of a novel class of proteins containing both a homeo- and a Cys-His domain. Nature (344):879-82
Links:MGI:1316702 same experiment
  Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceMGI