Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:3582

Prdm1 PR domain containing 1, with ZNF domain ( MGI:99655)
TS15 (9.0 dpc)
immunohistochemistry

Data Images
EMAGE:3582 EMAGE:3582
Fig4B.Copyright: Reprinted with permission from Elsevier from [doi:10.1016/S0925-4773(02)00189-2] Mech Dev 117: 305-9, Chang DH; Calame KL, The dynamic expression pattern of B lymphocyte induced maturation protein-1 (Blimp-1) during mouse embryonic development. Copyright 2002 Fig3.Copyright: Reprinted with permission from Elsevier from [doi:10.1016/S0925-4773(02)00189-2] Mech Dev 117: 305-9, Chang DH; Calame KL, The dynamic expression pattern of B lymphocyte induced maturation protein-1 (Blimp-1) during mouse embryonic development. Copyright 2002

Expression pattern clarity: three stars
Find spatially similar expression patterns: Find spatially similar patterns
Notes:
Image annotations: Transverse section through the lower abdomen of an E9 embryo. Expression is in the endodermal epithelium of midgut (arrow), and PGCs (primordial germ cells) in the urogenital ridge and dorsal mesentery (white arrows). Abbreviations: dm, dorsal mesentery; ugr, urogenital ridge. Scale bar indicates 1 micron. The cartoon shows approximate position of this section (4B).
Expression Pattern Description
Spatial Annotation:
EMAGE:3582EMAGE:3582Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
3D mappingspatial mapping

View mapped 3D expression image EMAGE genex expression entry
Download individual expression domains:
3582_voxel_strong_3D_1.wlz
3582_voxel_notDetected_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:3582_all_domains.zip
Find spatially similar expression patterns: EMAGE spatially similar patterns
Morphological match to the template: three stars
Text Annotation:
StructureLevelPatternNotes
midgut epithelium
detected detected
regionalExpression is present in the endodermal epithelium.
primordial germ cell
detected detected
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MGI:3603667
Entity Detected:Prdm1, PR domain containing 1, with ZNF domain ( MGI:99655)
Antigen:sense strand is shown

>MGI:3603667
SAREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTVINLTQTESNPKQYSSEKN
ELYPKSVPKREYSVKEILKLDSNPSKRKDIYRSNISPFTLEKDMDGFRKNGSPDMPFYPRVVYPIRAPLP
EDFLKASLAYGMERPTYITHSPLPSSTTPSPPASSSPEQSLKSSSPHSSPGNTVSPLAPGLPEHRDSYSY
L
aa 199 - aa 409 of AAA19252.1
Notes:The anti-Prdm1(Blimp-1) antibody used in this study by Chang & Calame (2002) [PMID:12204275] is described as "The monoclonal antibody, 3H2E8", "obtained after immunization with a peptide (amino acids 199-409) from mouse Blimp-1. The specificity of 3H2E8 was confirmed by positive immunocytostaining of endogenous Blimp-1 and ectopically expressed Blimp-1 in cells and negative staining following pre-absorption of 3H2E8 with Blimp-1 peptide (amino acids 199-409)"
Antibody Type:monoclonal
Catalogue Number:3H2E8
Specimen
Organism:mouse
Strain:either: BALB/c or C57BL/6
Age:9.0 dpc
Theiler Stage:TS15
Mutations:none (wild-type)
Preparation:section
Procedures
Fixation:4% paraformaldehyde
Secondary Antibody:anti-mouse IgG1
Labelled with:alkaline phosphatase
Visualisation method:NBT+BCIP
General Information
Authors:Chang DH; Calame KL (2002) [PMID:12204275] . Indexed by GXD, Spatially mapped by EMAGE
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/S0925-4773(02)00189-2] [ PMID:12204275] Chang DH, Calame KL 2002 The dynamic expression pattern of B lymphocyte induced maturation protein-1 (Blimp-1) during mouse embryonic development. Mech Dev (2002):305-9
Links:MGI:3603675 same experiment
  Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceMGI