Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:4044

Dtna dystrobrevin alpha ( MGI:106039)
TS15 (9.5 dpc)
immunohistochemistry

Data Images
EMAGE:4044
Figure 4A. Copyright: Reprinted with permission from Elsevier from [doi:10.1016/j.modgep.2004.01.015] Gene Expr Patterns 4: 583-93, Lien CF; Vlachouli C; Blake DJ; Simons JP; Gorecki DC, Differential spatio-temporal expression of alpha-dystrobrevin-1 during mouse development. Copyright 2004.

Expression pattern clarity: two stars
Find spatially similar expression patterns: Find spatially similar patterns
Notes:
Note: Arrows indicate isolated postive cells in otic vesicle.
Expression Pattern Description
Spatial Annotation:
EMAGE:4044EMAGE:4044Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
3D mappingspatial mapping

View mapped 3D expression image EMAGE genex expression entry
Download individual expression domains:
4044_voxel_strong_3D_1.wlz
4044_voxel_notDetected_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:4044_all_domains.zip
Find spatially similar expression patterns: EMAGE spatially similar patterns
Morphological match to the template: three stars
Text Annotation:
StructureLevelPatternNotes
otocyst
detected detected
single cell
surface ectoderm
detected detected
single cell
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MGI:3052477
Entity Detected:Dtna, dystrobrevin alpha ( MGI:106039)
Antigen:sense strand is shown

>MGI:3052477
LNSEVASETESTVDSEFSRPQFEDLAPSPTSEKAFLAQIHSRKPGYIHGGAASTTHGDMVPEDGDPYTQP
EDGNYENESVRQLENELQLEEYLKQKLQDEAYQVSLQG
aa 575 - aa 682 of NP_997533.1
Notes:The anti-Dtna antibody used in this study by Lien et al., 2004 [PMID:15261837] is indicated as the alpha1-CT-FP, a rabbit polyclonal affinity-purified antibody, described by Nawrotzki et al., 1998 [PMID:9701558] and Blake et al., 1998 [PMID:9419360] . Nawrotzki et al. describe this antibody as a "polyclonal antiserum that was generated against a fusion protein containing 107 amino acids of the unique carboxy terminus of a-dystrobrevin-1" and Blake et al. say that "the C terminus of a-dystrobrevin 1 (a1CT-FP) was produced as a glutathione S-transferase fusion protein by cloning [a] 1.1-kb EcoRI restriction fragment". Editor's Note: In the Mus musculus dystrobrevin alpha (Dtna), transcript variant 1, cDNA RefSeq NM_207650.3, EcoRI cuts at nt 2064 (324nt from the stop codon, i.e. 108aa from C terminus). Therefore the 107 amino acids described by Nawrotzki et al, are the most C-terminal 107 amino acids (i.e. aa 575-682 of NP_997533.1).
Antibody Type:polyclonal
Raised In:rabbit
Specimen
Organism:mouse
Strain:either: BALB/c or C57BL/10 or CD-1
Age:9.5 dpc
Theiler Stage:TS15
Mutations:none (wild-type)
Preparation:section
Procedures
Fixation:4% paraformaldehyde
Embedding:cryosection
Secondary Antibody:anti-rabbit biotinylated Ab
Labelled with:Vectastain ABC reagent
Visualisation method:Vector VIP substrate
General Information
Authors:Lien CF; Vlachouli C; Blake DJ; Simons JP; Gorecki DC, 2004 [PMID:15261837] . Indexed by GXD, Spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/j.modgep.2004.01.015] [ PMID:15261837] Lien CF, Vlachouli C, Blake DJ, Simons JP, Gorecki DC 2004 Differential spatio-temporal expression of alpha-dystrobrevin-1 during mouse development. Gene Expr Patterns (4):583-93
 [ doi:10.1073/pnas.95.1.241] [ PMID:9419360] Blake DJ, Nawrotzki R, Loh NY, Gorecki DC, Davies KE 1998 beta-dystrobrevin, a member of the dystrophin-related protein family. Proc Natl Acad Sci U S A (95):241-6
 [ PMID:9701558] Nawrotzki R; Loh NY; Ruegg MA; Davies KE; Blake DJ 1998 Characterisation of alpha-dystrobrevin in muscle. J Cell Sci (111):2595-605
Links:MGI:3052503 same experiment
  Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceMGI