Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:4363

Ufd1l ubiquitin fusion degradation 1 like ( MGI:109353)
TS15 (10/10.5 dpc)
immunohistochemistry

Data Images
EMAGE:4363
Figure 1G. Copyright: This image is from Maynard TM, Proc Natl Acad Sci U S A 2003 Nov 25;100(24):14433-8. Copyright 2003 National Academy of Sciences, U.S.A.

Expression pattern clarity: two stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Expression Pattern Description
Spatial Annotation:
EMAGE:4363Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
4363_wholemount_strong_3D_1.wlz
4363_wholemount_moderate_3D_1.wlz
4363_wholemount_possible_3D_1.wlz
4363_wholemount_notDetected_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:4363_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: two stars
Text Annotation:
StructureLevelPatternNotes
branchial arch
detected detected
forelimb bud
detected detected
arterial system
detected detected
heart
detected detected
future forebrain
detected detected
fronto-nasal process
detected detected
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MGI:3028135
Entity Detected:Ufd1l, ubiquitin fusion degradation 1 like ( MGI:109353)
Antigen:sense strand is shown

>MGI:3028135
ATYSKFQPQSPDFLDITNPKAVLENALRDFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNV
DFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKG
aa 120 - aa 241 of NP_035802.2
Notes:The anti-Ufd1l antibody used in this study by Maynard et al., 2003 [PMID:14614146] was obtained from Transduction Laboratories. Editors Note: BD Transduction Laboratories produce one anti-Ufd1l antisera, which has immunoreactivity with rat, mouse and human Ufd1l (catalogue number 611642). Its immunogen spans aa120-241 of mouse Ufd1l.
Antibody Type:monoclonal
Raised In:mouse
Supplier:BD Transduction Laboratories
Catalogue Number:611642
Specimen
Organism:mouse
Strain:ICR
Age:10/10.5 dpc
Theiler Stage:TS15
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Fixation:2.5% paraformaldehyde
General Information
Authors:Maynard TM; Haskell GT; Peters AZ; Sikich L; Lieberman JA; LaMantia AS, 2003 [PMID:14614146] . Indexed by GXD, Spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1073/pnas.2235651100] [ PMID:14614146] Maynard TM, Haskell GT, Peters AZ, Sikich L, Lieberman JA, LaMantia AS 2003 A comprehensive analysis of 22q11 gene expression in the developing and adult brain. Proc Natl Acad Sci U S A (100):14433-8
Links:MGI:3028321 same experiment
  Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceMGI