| Type: | antibody |
| Identifier: | MGI:3028135 |
| Entity Detected: | Ufd1l, ubiquitin fusion degradation 1 like ( MGI:109353) |
| Antigen: | sense strand is shown
>MGI:3028135
ATYSKFQPQSPDFLDITNPKAVLENALRDFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNV
DFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKG
|
| | aa 120 - aa 241 of NP_035802.2 |
| Notes: | The anti-Ufd1l antibody used in this study by Maynard et al., 2003 [PMID:14614146] was obtained from Transduction Laboratories. Editors Note: BD Transduction Laboratories produce one anti-Ufd1l antisera, which has immunoreactivity with rat, mouse and human Ufd1l (catalogue number 611642). Its immunogen spans aa120-241 of mouse Ufd1l. |
| Antibody Type: | monoclonal |
| Raised In: | mouse |
| Supplier: | BD Transduction Laboratories |
| Catalogue Number: | 611642 |