Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:4546

Mef2c myocyte enhancer factor 2C ( MGI:99458)
TS17 (10.5-11.0 dpc)
immunohistochemistry

Data Images
EMAGE:4546
Fig 1N Copyright: Reprinted with permission from Elsevier from [doi:10.1016/0925-4773(96)00542-4] Mech Dev 57: 103-112, Subramanian SV, Nadal-Ginard B., Early expression of the different isoforms of the myocyte enhancer factor-2 (MEF2) protein in myogenic as well as non-myogenic cell lineages during mouse embryogenesis. Copyright 1996

Expression pattern clarity: two stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Notes:
Image annotations: arrows - MEF2C positive cells are seen as streaks in the middle of the condensed somite.
Expression Pattern Description
Spatial Annotation:
EMAGE:4546Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
4546_wholemount_moderate_3D_1.wlz
4546_wholemount_weak_3D_1.wlz
4546_wholemount_possible_3D_1.wlz
4546_wholemount_notDetected_3D_1.wlz
4546_wholemount_strong_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:4546_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: three stars
Text Annotation:
StructureLevelPatternNotes
trunk somite
detected detected
Approximately 25-27 somites show MEF2C-positive cells. MEF2C-positive cells are seen as streaks in the middle of the condensed somite (Fig1N, arrows). As development proceeds, the number of MEF2C-positive cells increases within each somite. MEF2C expression is restricted to the somites and heart. Expression is not detected in the intersomitic spaces.
heart
detected detected
MEF2C expression is restricted to the somites and heart.
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:MEF2C antibodyA
Entity Detected:Mef2c, myocyte enhancer factor 2C ( MGI:99458)
Antigen:sense strand is shown

>MEF2C antibodyA
TLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTS
THLSQSSNLSLPSTQSLSIKSEPVSPPRDRTTTPSRYPQHTTRHEAGRSPVDSLSSCSSSYDGSDREDHR
NEFHSPIGLTRPSPDERESPSVKRMRLSEGWA
aa 294 - aa 465 of EDL37147.1
Notes:The anti-MEF2C antibody used in this study by Subramanian & Nadal-Ginard 1996 [PMID:8817457] is described as "a rabbit polyclonal antisera specific for MEF2C which was raised against a pGEX-GST bacterial fusion protein containing the C-terminal amino acids 294-465, according to standard procedures". Editors note: See Martin et al 1993 [PMID:8506376] Fig 1A for the mouse MEF2C amino acid sequence. As indicated, there are multiple isoforms of MEF2C (EDL37146.1, EDL37147.1, EDL37148.1, EDL37149.1). Of these only EDL37147.1 represents a 465 amino acid form, therefore it is assumed the amino acid numbering used by Subramanian & Nadal-Ginard 1996 refers to this isoform.
Antibody Type:polyclonal
Raised In:rabbit
Specimen
Organism:mouse
Strain:either: CD-1 or C57BL/6
Age:10.5-11.0 dpc
Theiler Stage:TS17
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Fixation:methanol/DMSO (4:l)
Secondary Antibody:goat anti-rabbit
Labelled with:horse radish peroxidase
Visualisation method:DABThe anti
General Information
Authors:Subramanian SV, Nadal-Ginard B. 1996. [PMID:8817457] . Indexed and spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/0925-4773(96)00542-4] [ PMID:8817457] Subramanian SV, Nadal-Ginard B 1996 Early expression of the different isoforms of the myocyte enhancer factor-2 (MEF2) protein in myogenic as well as non-myogenic cell lineages during mouse embryogenesis. Mech Dev (57):103-12
 [ doi:10.1073/pnas.90.11.5282] [ PMID:8506376] Martin JF, Schwarz JJ, Olson EN 1993 Myocyte enhancer factor (MEF) 2C: a tissue-restricted member of the MEF-2 family of transcription factors. Proc Natl Acad Sci U S A (90):5282-6
Links: Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceEMAGE