Type: | antibody |
Identifier: | MEF2C antibodyA |
Entity Detected: | Mef2c, myocyte enhancer factor 2C ( MGI:99458) |
Antigen: | sense strand is shown
>MEF2C antibodyA
TLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPPSALSQLGACTS
THLSQSSNLSLPSTQSLSIKSEPVSPPRDRTTTPSRYPQHTTRHEAGRSPVDSLSSCSSSYDGSDREDHR
NEFHSPIGLTRPSPDERESPSVKRMRLSEGWA
|
| aa 294 - aa 465 of EDL37147.1 |
Notes: | The anti-MEF2C antibody used in this study by Subramanian & Nadal-Ginard 1996 [PMID:8817457] is described as "a rabbit polyclonal antisera specific for MEF2C which was raised against a pGEX-GST bacterial fusion protein containing the C-terminal amino acids 294-465, according to standard procedures".
Editors note: See Martin et al 1993 [PMID:8506376] Fig 1A for the mouse MEF2C amino acid sequence. As indicated, there are multiple isoforms of MEF2C (EDL37146.1, EDL37147.1, EDL37148.1, EDL37149.1). Of these only EDL37147.1 represents a 465 amino acid form, therefore it is assumed the amino acid numbering used by Subramanian & Nadal-Ginard 1996 refers to this isoform. |
Antibody Type: | polyclonal |
Raised In: | rabbit |