Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:4710

Ngfr nerve growth factor receptor (TNFR superfamily, member 16) ( MGI:97323)
TS15 (9.5 dpc)
immunohistochemistry

Data Images
EMAGE:4710
Fig3C-E9.5-wt Guris DL; Fantes J; Tara D; Druker BJ; Imamoto A. "Mice lacking the homologue of the human 22q11.2 gene CRKL phenocopy neurocristopathies of DiGeorge syndrome." Nat Genet 2001. 27:293-8. [doi:10.1038/85855]

Expression pattern clarity: three stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Expression Pattern Description
Spatial Annotation:
EMAGE:4710Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
4710_wholemount_moderate_3D_1.wlz
4710_wholemount_weak_3D_1.wlz
4710_wholemount_notDetected_3D_1.wlz
4710_wholemount_strong_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:4710_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: three stars
Text Annotation:
StructureLevelPatternNotes
rhombomere 02
detected detected
regionalExpressed in neural crest cells emigrating in a segmental pattern from rhombomeres 2, 4, 6, 7 and 8.
rhombomere 04
detected detected
regionalExpressed in neural crest cells emigrating in a segmental pattern from rhombomeres 2, 4, 6, 7 and 8.
rhombomere 06
detected detected
regionalExpressed in neural crest cells emigrating in a segmental pattern from rhombomeres 2, 4, 6, 7 and 8.
rhombomere 07
detected detected
regionalExpressed in neural crest cells emigrating in a segmental pattern from rhombomeres 2, 4, 6, 7 and 8.
rhombomere 08
detected detected
regionalExpressed in neural crest cells emigrating in a segmental pattern from rhombomeres 2, 4, 6, 7 and 8.
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:Ngfr antibodyA
Entity Detected:Ngfr, nerve growth factor receptor (TNFR superfamily, member 16) ( MGI:97323)
Antigen:sense strand is shown

>Ngfr antibodyA
FKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPL
TKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIV
ESLCSESTATSPV
aa 273 - aa 425 of NP_036742.1
Notes:The anti-Ngfr (p75 low affinity NGF receptor carboxy-terminal peptide) antibody used in this study by Guris et al., 2001 [PMID:11242111] was a "rabbit polyclonal from BAbCO". Editors Note: Covance/BAbCO sell two anti-p75 Neurotrophin Receptor polyclonal products (purified antibody or unpurified antiserum), which are raised against the same antigen: residues 273-425 of a bacterially expressed rat p75NTR. This sequence comprises the C-terminal intracellular domain.
Antibody Type:polyclonal
Raised In:rabbit
Supplier:BAbCO/Covance
Catalogue Number:either: PRB-608P or PRB-602C
Specimen
Organism:mouse
Age:9.5 dpc
Theiler Stage:TS15
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Fixation:methanol/DMSO 4:1
Secondary Antibody:goat anti-rabbit
Labelled with:horse radish peroxidase
Visualisation method:4-chloro-1-naphthol
General Information
Authors:Guris DL; Fantes J; Tara D; Druker BJ; Imamoto A, 2001 [PMID:11242111] . Indexed and spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1038/85855] [ PMID:11242111] Guris DL, Fantes J, Tara D, Druker BJ, Imamoto A 2001 Mice lacking the homologue of the human 22q11.2 gene CRKL phenocopy neurocristopathies of DiGeorge syndrome. Nat Genet (27):293-8
Links: Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceEMAGE