Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:4815

Cdh4 cadherin 4 ( MGI:99218)
TS17 (10.5 dpc)
immunohistochemistry

Data Images
EMAGE:4815
Fig 1B. Copyright: This image is from Inoue T; Tanaka T; Takeichi M; Chisaka O; Nakamura S; Noriko O, Development 2001;128(4):561-9 and is displayed with the permission of The Company of Biologist Limited who owns the Copyright. [PMID:11171339]

Expression pattern clarity: three stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Notes:
Note that this is a dissected brain. Image annotations: arrowheads indicate the expression limit for Rcad (Cdh4) in the telencephalon.
Expression Pattern Description
Spatial Annotation:
EMAGE:4815Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
4815_wholemount_moderate.wlz
4815_wholemount_notDetected.wlz
4815_wholemount_strong.wlz
4815_wholemount_weak.wlz
(what is wlz format?)
Download all expression domains: EMAGE:4815_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: two stars
Text Annotation:
StructureLevelPatternNotes
brain
detected detected
regionalRcad delineates the future cerebral cortex.
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:Cdh4 antibodyA
Entity Detected:Cdh4, cadherin 4 ( MGI:99218)
Antigen:sense strand is shown

>Cdh4 antibodyA
GIQMSFQSTAGVTISVTDVNEAPYFPSNHKLIRLEEGVPAGTALTTFSAVDPDRFMQQAVRYSKLSDPAN
WLHINTSNGQITTAAILDRESLYTKNNVYEATFLAADNGIP
aa 480 - aa 590 of NP_033997.1
Notes:The anti-Cdh4 (R-cadherin/Rcad) antibody used in this study by Inoue et al., 2001 [PMID:11171339] is indicated as that used by Matsunami & Takeichi, 1995 [PMID:8612964] . Matsunami & Takeichi describe production of a monoclonal antibody (MRCD-5) against R-cadherin. The antigen used to generate it was a fusion protein prepared as described by Matsunami et al., 1993 [PMID:8270638] i.e. "The BamHI fragment of mouse R-cadherin cDNA, encoding 111 amino acids from position 480 to 590, was inserted into the BamHI site of pGEX-3X vector (Pharmacia, Sweden)."
Antibody Type:monoclonal
Raised In:rat
Specimen
Organism:mouse
Age:10.5 dpc
Theiler Stage:TS17
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Secondary Antibody:anti-rat
Labelled with:horse radish peroxidase
General Information
Authors:Inoue T; Tanaka T; Takeichi M; Chisaka O; Nakamura S; Noriko O, 2001 [PMID:11171339] , Indexed and Spatially Mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ PMID:11171339] Inoue T, Tanaka T, Takeichi M, Chisaka O, Nakamura S, Osumi N 2001 Role of cadherins in maintaining the compartment boundary between the cortex and striatum during development. Development (128):561-9
 [ doi:10.1006/dbio.1995.8029] [ PMID:8612964] Matsunami H, Takeichi M 1995 Fetal brain subdivisions defined by R- and E-cadherin expressions: evidence for the role of cadherin activity in region-specific, cell-cell adhesion. Dev Biol (172):466-78
 [ PMID:8270638] Matsunami H, Miyatani S, Inoue T, Copeland NG, Gilbert DJ, Jenkins NA, Takeichi M 1993 Cell binding specificity of mouse R-cadherin and chromosomal mapping of the gene. J Cell Sci (106 ( Pt 1)):401-9
Links: Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceEMAGE