Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:4918

Reck reversion-inducing-cysteine-rich protein with kazal motifs ( MGI:1855698)
TS17 (10.5 dpc)
immunohistochemistry

Data Images
EMAGE:4918 EMAGE:4918 EMAGE:4918
Figure 4A. Copyright: Reprinted with permission from Cell Press from [doi:10.1016/S0092-8674(01)00597-9] Cell 107: 789-800, Oh J; Takahashi R; Kondo S; Mizoguchi A; Adachi E; Sasahara RM; Nishimura S; Imamura Y; Kitayama H; Alexander DB; Ide C; Horan TP; Arakawa T; Yoshida H; Nishikawa S; Itoh Y; Seiki M; Itohara S; Takahashi C; Noda M, "The membrane-anchored MMP inhibitor RECK is a key regulator of extracellular matrix integrity and angiogenesis." Copyright 2001 [PMID:11747814] Figure 4A. Copyright: Reprinted with permission from Cell Press from [doi:10.1016/S0092-8674(01)00597-9] Cell 107: 789-800, Oh J; Takahashi R; Kondo S; Mizoguchi A; Adachi E; Sasahara RM; Nishimura S; Imamura Y; Kitayama H; Alexander DB; Ide C; Horan TP; Arakawa T; Yoshida H; Nishikawa S; Itoh Y; Seiki M; Itohara S; Takahashi C; Noda M, "The membrane-anchored MMP inhibitor RECK is a key regulator of extracellular matrix integrity and angiogenesis." Copyright 2001 [PMID:11747814] Figure 4A. Copyright: Reprinted with permission from Cell Press from [doi:10.1016/S0092-8674(01)00597-9] Cell 107: 789-800, Oh J; Takahashi R; Kondo S; Mizoguchi A; Adachi E; Sasahara RM; Nishimura S; Imamura Y; Kitayama H; Alexander DB; Ide C; Horan TP; Arakawa T; Yoshida H; Nishikawa S; Itoh Y; Seiki M; Itohara S; Takahashi C; Noda M, "The membrane-anchored MMP inhibitor RECK is a key regulator of extracellular matrix integrity and angiogenesis." Copyright 2001 [PMID:11747814]

Expression pattern clarity: two stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Notes:
Note: A wild-type embryo was cut sagittally into two pieces, and whole-mount immunostaining was performed with (left) or without (middle) anti-RECK antibodies. The anterior half of the embryo cut transversally at the abdominal level (as shown in the middle figure) was also stained with anti-RECK antibodies (right).
Expression Pattern Description
Spatial Annotation:
EMAGE:4918Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
4918_wholemount_moderate_3D_1.wlz
4918_wholemount_weak_3D_1.wlz
4918_wholemount_possible_3D_1.wlz
4918_wholemount_strong_3D_1.wlz
(what is wlz format?)
Download all expression domains: EMAGE:4918_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: three stars
Text Annotation:
StructureLevelPatternNotes
mesenchyme
detected detected
regionalWidely expressed in mesenchymal tissues.
neural tube
detected detected
regionalRelatively abundant in the marginal zone of the neural tube.
dorsal aorta
detected detected
RECK protein is relatively abundant in the large blood vessels such as the dorsal aorta
cardiovascular system
detected detected
regionalAround the dorsal aorta, the staining pattern for RECK resembles that for alpha-smooth muscle actin (SMA), suggesting that RECK expression is relatively high in vascular smooth muscle cells.
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:Reck antibody A
Entity Detected:Reck, reversion-inducing-cysteine-rich protein with kazal motifs ( MGI:1855698)
Antigen:sense strand is shown

>Reck antibody A
ECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEKLDTIAKVTNKKPITVLEILQKIRMHVSVPQ
CDVFGYFSIESEIVILIIPVDHYPKALQIEACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSV
PSAGVRARPSCHSLLLPLSLGLALHLLWTYN
aa 801 - aa 971 of NP_066934.1
Notes:The anti-Reck antibody used in this study by Oh et al., 2001 [PMID:11747814] was "5B11D12", originally described in Takahashi et al., 1998 [PMID:9789069] as follows: a "mAb was generated by using a bacterially expressed COOH-terminal fragment of the hRECK protein (residues 801-971 for antibody 5B11D12)". "The mouse mAb 5B11D12 was generated as described by Harlow and Lane (1988) in 'Antibodies: A Laboratory Manual (Cold Spring Harbor Lab. Press, Plainview, NY), pp 139-283.' "
Antibody Type:monoclonal
Raised In:mouse
Specimen
Organism:mouse
Age:10.5 dpc
Theiler Stage:TS17
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Labelled with:horse radish peroxidase
Visualisation method:DAB
General Information
Authors:Oh J; Takahashi R; Kondo S; Mizoguchi A; Adachi E; Sasahara RM; Nishimura S; Imamura Y; Kitayama H; Alexander DB; Ide C; Horan TP; Arakawa T; Yoshida H; Nishikawa S; Itoh Y; Seiki M; Itohara S; Takahashi C; Noda M, 2001 [PMID:11747814] . Indexed and spatially mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/S0092-8674(01)00597-9] [ PMID:11747814] Oh J, Takahashi R, Kondo S, Mizoguchi A, Adachi E, Sasahara RM, Nishimura S, Imamura Y, Kitayama H, Alexander DB, Ide C, Horan TP, Arakawa T, Yoshida H, Nishikawa S, Itoh Y, Seiki M, Itohara S, Takahashi C, Noda M 2001 The membrane-anchored MMP inhibitor RECK is a key regulator of extracellular matrix integrity and angiogenesis. Cell (107):789-800
 [ doi:10.1073/pnas.95.22.13221] [ PMID:9789069] Takahashi C, Sheng Z, Horan TP, Kitayama H, Maki M, Hitomi K, Kitaura Y, Takai S, Sasahara RM, Horimoto A, Ikawa Y, Ratzkin BJ, Arakawa T, Noda M 1998 Regulation of matrix metalloproteinase-9 and inhibition of tumor invasion by the membrane-anchored glycoprotein RECK. Proc Natl Acad Sci U S A (95):13221-6
Links: Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceEMAGE