| Type: | antibody |
| Identifier: | Ddx4 antibodyA |
| Entity Detected: | Ddx4, DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 ( MGI:102670) |
| Antigen: | sense strand is shown
>Ddx4 antibodyA
MGDEDWEAEILKPHVSSYVPVFEKDKYSSGANGDTFNRTSASSDIGESSKKENTSTTGGFGRGKGFGNRG
FLNNKFEEGDSSGFWKESNNDCEDNQTRSRGFSKRGGCQDGNDSEASGPFRRGGRGSFRGCRGGFGLGRP
NSESDQDQGTQRGGGLFGSRKPAASDSGNGDTYQSRSGSGRGGYKGLNEEVVTGSGKNSWKSETEGGESS
DSQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAG
YTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTREL
INQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDE
ADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRDVQQ
TILQVGQYSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFR
CGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLV
KVLSDAQQDVPAWLEEIAFSTYVPPSFSSSTRGGAVFASVDTRKNYQGKHTLNTAGISSSQAPNPVDDES
|
| | aa 1 - aa 700 of NP_034159.1 |
| Notes: | The anti-DDX4 (MVH) antibody used in this study by Toyooka et al., 2000 [PMID:10781947] was produced as described here: "A full-length Mvh cDNA fragment appended BamHI and SalI sites at the 5' and 3' ends, respectively, and was generated by PCR amplification using mouse testis cDNAs as templates (primers, 5'-ggatccGAACCTGAAGCTATCATGGGA-3' and 5'-gtcgacCCATGA TTCGTCATCAACTGG-3'). The cDNA fragment (2.1 kb) was subcloned in frame into the BamHI/SalI site of the glutathione S-transferase (GST)-tagged expression vector pGEX-4T-1 (Pharmacia). The GST-MVH fusion protein produced in Escherichia coli was purified using a GST gene fusion system (Pharmacia) according to the manufacturer's instructions and was concentrated using a centrifugal concentrator (Centriplus, Amicon) to a final concentration of 0.3 mg/ml. Approximately 300 ug of purified protein was emulsified in Freund's complete adjuvant (DIFCO), and injected subcutaneously into a rabbit four times at 2-week intervals. The antiserum was purified by affinity chromatography using agarose-gel beads coupled with GST-MVH fusion protein and the resulting solution of purified antibodies (0.43 mg protein/ml) was used as an original solution of anti-MVH antibody."
Editors Note: the PCR amplified region used to generate the antigen covers nt 27-2144 of the mouse Ddx4 cDNA RefSeq NM_010029.1 (CDS 42..2150) - i.e. all but the last two amino acids. |
| Antibody Type: | polyclonal |
| Raised In: | rabbit |
icon to keep this page displayed.)
