Quicksearch Help

(Click the icon to keep this page displayed.)

EMAGE:5011

Dnmt3b DNA methyltransferase 3B ( MGI:1261819)
TS15 (9.5 dpc)
immunohistochemistry

Data Images
EMAGE:5011
Fig1A(9.5) Copyright: Reprinted with permission from Elsevier from [doi:10.1016/S0925-4773(02)00242-3] Mech Dev 118(1-2): 187-190, Watanabe D; Suetake I; Tada T; Tajima S, Stage- and cell-specific expression of Dnmt3a and Dnmt3b during embryogenesis. Copyright 2002. [PMID:12351185]

Expression pattern clarity: three stars
Find spatially similar wholemount expression patterns: Find spatially similar wholemount patterns
Notes:
Image annotations: arrow indicates headfolds.
Expression Pattern Description
Spatial Annotation:
EMAGE:5011Annotation colour key:  
strong strong      
gene expression moderate moderate    
gene expression weak weak        
gene expression possible possible    
gene expression not detected not detected
wholemount mapping

Download individual expression domains:
5011_wholemount_moderate.wlz
5011_wholemount_notDetected.wlz
5011_wholemount_strong.wlz
(what is wlz format?)
Download all expression domains: EMAGE:5011_all_domains.zip
Find spatially similar wholemount expression patterns:  EMAGE spatially similar wholemount patterns
Morphological match to the template: two stars
Text Annotation:
StructureLevelPatternNotes
future brain
weak weak
regionalDnmt3b was weakly detected in the head folds, but at very low level in E9.5 embryos.
Annotation Validation: EMAGE Editor
Detection Reagent
Type:antibody
Identifier:Dnmt3b antibodyA
Entity Detected:Dnmt3b, DNA methyltransferase 3B ( MGI:1261819)
Antigen:sense strand is shown

>Dnmt3b antibodyA
MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRGRRSSSRLSKREV
SSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPAVRTRHSNGTSSLERQRASPRIT
RGRQGRHHVQEYPVEFPATRSRRRRASSSASTPWSSPASVD
aa 1 - aa 181 of AAC40178.2
Notes:Dnmt3b expression was detected in this study by Watanabe et al., 2002 [PMID:12351185] using antibodies raised against DNMT3B protein. The production of the antisera was previously described by Aoki et al., 2001 [PMID:11522819] as follows, "Antisera reacted with mouse Dnmt3b was raised against maltose binding protein fusion protein, and an antiserum reacted with glutathione S-transferase (GST) was raised against GST. The antibodies raised in rabbits were immunoselected using GST fusion protein- or GST-coupled Sepharose as affinity matrices. To this end, a DNA [1-662 (SalI), encoding amino acids 1-181] of mouse Dnmt3b1 (accession no. AF068626) was ligated into pMAL-c2 (NEB, MA) and pGEX vectors, and expressed in BL21(DE3) in the presence of IPTG."
Antibody Type:polyclonal
Raised In:rabbit
Specimen
Organism:mouse
Strain:ICR
Age:9.5 dpc
Theiler Stage:TS15
Mutations:none (wild-type)
Preparation:wholemount
Procedures
Fixation:acetone
Secondary Antibody:anti-rabbit IgG
Labelled with:ALEXA568
Visualisation method:fluorescence
General Information
Authors:Watanabe D; Suetake I; Tada T; Tajima S, 2002 [PMID:12351185] , Indexed and Spatially Mapped by EMAGE.
Submitted by:EMAGE EDITOR, Institute of Genetics and Molecular Medicine, Western General Hospital, Crewe Road, Edinburgh, UK EH4 2XU
Experiment type:non-screen
References:[ doi:10.1016/S0925-4773(02)00242-3] [ PMID:12351185] Watanabe D, Suetake I, Tada T, Tajima S 2002 Stage- and cell-specific expression of Dnmt3a and Dnmt3b during embryogenesis. Mech Dev (118):187-90
 [ doi:10.1093/nar/29.17.3506] [ PMID:11522819] Aoki A, Suetake I, Miyagawa J, Fujio T, Chijiwa T, Sasaki H, Tajima S 2001 Enzymatic properties of de novo-type mouse DNA (cytosine-5) methyltransferases. Nucleic Acids Res (29):3506-12
Links: Ensembl same gene
  Allen Brain Atlas same gene
  BioGPS same gene
  International Mouse Knockout Project Status same gene
  GEISHA Chicken ISH Database same gene
  EMBL-EBI Gene Expression Atlas same gene
  BrainStars same gene
  ViBrism same gene
Data SourceEMAGE