Type: | antibody |
Identifier: | Dnmt3b antibodyA |
Entity Detected: | Dnmt3b, DNA methyltransferase 3B ( MGI:1261819) |
Antigen: | sense strand is shown
>Dnmt3b antibodyA
MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEAICTEPVCTPETRGRRSSSRLSKREV
SSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLTRETKDTRTRSESPAVRTRHSNGTSSLERQRASPRIT
RGRQGRHHVQEYPVEFPATRSRRRRASSSASTPWSSPASVD
|
| aa 1 - aa 181 of AAC40178.2 |
Notes: | Dnmt3b expression was detected in this study by Watanabe et al., 2002 [PMID:12351185] using antibodies raised against DNMT3B protein. The production of the antisera was previously described by Aoki et al., 2001 [PMID:11522819] as follows, "Antisera reacted with mouse Dnmt3b was raised against maltose binding protein fusion protein, and an antiserum reacted with glutathione S-transferase (GST) was raised against GST. The antibodies raised in rabbits were immunoselected using GST fusion protein- or GST-coupled Sepharose as affinity matrices. To this end, a DNA [1-662 (SalI), encoding amino acids 1-181] of mouse Dnmt3b1 (accession no. AF068626) was ligated into pMAL-c2 (NEB, MA) and pGEX vectors, and expressed in BL21(DE3) in the presence of IPTG." |
Antibody Type: | polyclonal |
Raised In: | rabbit |