| Type: | antibody |
| Identifier: | MGI:3603667 |
| Entity Detected: | Prdm1, PR domain containing 1, with ZNF domain ( MGI:99655) |
| Antigen: | sense strand is shown
>MGI:3603667
SAREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTVINLTQTESNPKQYSSEKN
ELYPKSVPKREYSVKEILKLDSNPSKRKDIYRSNISPFTLEKDMDGFRKNGSPDMPFYPRVVYPIRAPLP
EDFLKASLAYGMERPTYITHSPLPSSTTPSPPASSSPEQSLKSSSPHSSPGNTVSPLAPGLPEHRDSYSY
L
|
| | aa 199 - aa 409 of AAA19252.1 |
| Notes: | The anti-Prdm1(Blimp-1) antibody used in this study by Chang & Calame (2002) [PMID:12204275] is described as "The monoclonal antibody, 3H2E8", "obtained after immunization with a peptide (amino acids 199-409) from mouse Blimp-1. The specificity of 3H2E8 was confirmed by positive immunocytostaining of endogenous Blimp-1 and ectopically expressed Blimp-1 in cells and negative staining following pre-absorption of 3H2E8 with Blimp-1 peptide (amino acids 199-409)" |
| Antibody Type: | monoclonal |
| Catalogue Number: | 3H2E8 |